Sermorelin
£39.95
10 mg · Lyophilised powder, sealed vial
CAS 86168-78-7
Documentation pending
Check or request batch documents
Research use only. Supplied for lawful in-vitro laboratory research. Not a medicine. Not for human or veterinary use, ingestion or administration. Purchasers must be 18 or over.
Out of stock
Payment: Pay by Bank, securely through your banking app.
10 mg lyophilised Sermorelin reference material in a sealed vial, with product-specific cool storage information.
About this material
Sermorelin is the amidated 29-amino-acid GRF(1–29) fragment of human growth hormone-releasing hormone, supplied as a 10 mg lyophilised reference material in a sealed vial.
Technical record: CAS 86168-78-7 · molecular formula C149H246N44O42S · molecular weight 3357.88 g/mol.
What you receive
A sealed vial of 10 mg lyophilised powder presented for laboratory and analytical research. Review the storage requirement and current documentation status before ordering.
Storage
Supplied lyophilised and shipped at ambient temperature. On arrival, store at 2–8 °C, desiccated and protected from light. Consult the safety data sheet before handling.
Research use only. Supplied for lawful in-vitro laboratory and analytical research. Not a medicine. Not for human or veterinary use, ingestion or administration. Purchasers must be 18 or over.
Check the supporting record
Match the catalogue code and lot to the document before relying on it. Use the COA checklist and identity checklist; request any missing batch or identity details through documentation.
Specification
| Catalogue number | AV-SERM-010 |
|---|---|
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.88 g/mol |
| CAS number | 86168-78-7 |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 aa) |
| Purity specification | Pending release — see documentation status |
| Physical form | Lyophilised powder, sealed vial |
| Storage | 2–8 °C, desiccated, protect from light |
Batch documentation
Batch identifier not published. Use the lot number on your vial when requesting records.
